What LL-37 is
LL-37 is the mature, active form of the human cathelicidin antimicrobial peptide, produced by proteolytic processing of the hCAP18 precursor. It is a foundational research tool in innate immunity and antimicrobial-peptide biology.
Molecular information
- Sequence: [LL-37, 37 aa]
- Number of residues: 37
- Approximate monoisotopic mass: ~4493 Da (as the free acid)
- Physical form: Typically supplied as a white lyophilised powder
Areas of published research
LL-37 has been extensively studied across innate-immunity, antimicrobial and wound-repair research contexts. At 37 residues, it is on the larger end of research peptides; identity confirmation typically uses electrospray LC-MS with a well-optimised method for a peptide of its size and hydrophobicity.
Analytical considerations
Standard research-peptide analytical checks apply: identity confirmation by mass spectrometry (see LC-MS peptide testing explained), purity assessment by reversed-phase HPLC at 214 nm (see what is HPLC peptide testing), and batch-specific documentation (see how to read a peptide COA). Refer to the Peptovia Research Certificate of Analysis page for live examples of the analytical format used for batches supplied.
Further reading
Peer-reviewed literature on LL-37 is accessible via PubMed and specialist journals. Readers are encouraged to evaluate primary sources directly rather than relying on secondary summaries.
Research Use Only. This profile is an educational overview of LL-37 as a research peptide. It does not describe or recommend human, veterinary or clinical use. Peptovia Research supplies LL-37 strictly for in-vitro laboratory research. No dosing, administration or therapeutic guidance is provided or implied.